Sermorelin 5mg

Name: Sermorelin 5mg
Brand: Core Research Peptides
SKU: CRP-SER-5
Price: 43.00 USD
Availability: InStock

Original price was: $49.00.Current price is: $43.00.Arrives in 2 to 5 business days

Availability: In Stock

Sealed and unused? Return it within 14 days for a full refund.

Ask a question about this product

In Stock

Reconstitution quick calc

Vial mg + diluent mL

Enter vial contents and volume.

Open the full calculator →

You'll also need: Reconstitution Solution - $12.00

+ Add

Ordering for a lab or organization? Volume pricing is available on recurring and bulk orders.

Professional & Bulk Pricing

Research Background

About Sermorelin 5mg

What it is

Sermorelin is a synthetic 29-amino-acid peptide corresponding to the first 29 residues of human growth hormone-releasing hormone (GHRH), with a C-terminal amide. It is supplied as 5mg of lyophilized powder in a sealed vial for laboratory research use.

Research areas

Sermorelin has been investigated in preclinical research on GHRH receptor pharmacology and pituitary cell signaling. Laboratory studies have used it as a reference agonist when characterizing modified GHRH analogs.

Storage & handling

Store the lyophilized powder at -20°C, protected from light. After reconstitution, keep refrigerated and minimize freeze-thaw cycling.

Research context

Sermorelin represents the shortest GHRH sequence shown to retain full receptor activity, which made it the starting point for later analogs such as CJC-1295. It is frequently referenced in comparative literature on GHRH-class peptides and their degradation half-lives.

All compounds are supplied for in-vitro laboratory research and identification purposes. For research use only.

🧬

Compound Specifications

Compound	Sermorelin
Scientific Name	Sermorelin (GRF 1-29 NH₂) - GHRH (1-29) Analog
Sequence / Structure	YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ (29 aa)
Molecular Formula	C₁₄₉H₂₄₆N₄₄O₄₂S
Molecular Weight	3,357.9 Da
CAS Number	86168-78-7
Purity Standard	99%
Physical Form	Lyophilized powder
Storage Conditions	-20°C long-term; 2–8°C short-term

Sermorelin 5mg is a GHRH (1-29) analog from Core Research Peptides, supplied as 5mg of lyophilized powder at 99 percent purity under SKU CRP-SER-5. Preclinical research uses it as a reference agonist at the growth hormone releasing hormone receptor in pituitary signaling studies. Core Research Peptides lists it at $43.00, in stock and dispatched the same day, 7 days a week, on orders placed by 3 PM Central.

Quick answers

What is Sermorelin 5mg studied for?

Sermorelin reproduces the first 29 residues of GHRH, the shortest fragment that keeps full activity at the GHRH receptor. Laboratory work uses it as a reference GHRH receptor agonist and compares it with modified analogs such as CJC-1295.

What are the specifications for Sermorelin 5mg?

Sermorelin is GRF 1-29 NH2, a 29 amino acid peptide, CAS 86168-78-7, molecular weight about 3,357.9 Da. Core Research Peptides supplies 5mg of lyophilized powder per vial at 99 percent purity under SKU CRP-SER-5, in the Growth Factor Peptides category.

How much is Sermorelin 5mg and how fast does it ship?

Sermorelin 5mg is $43.00 at coreresearchpeptides.com, in stock and dispatched the same day, 7 days a week, on orders placed by 3 PM Central. Two, three and five vial orders lower the per vial price in the cart with no code. Standard, expedited and overnight shipping are offered at checkout.

GHRH (1-29) analog, the shortest fully active GHRH fragment. 5mg lyophilized, 99% purity, in stock in the United States and dispatched the same day before 3 PM Central.

Bundle pricing, applied automatically in the cart. No code needed.
Qty	Per vial	Total	You save
Single vial	$43	$43	–
2-Pack	$41.99	$83.98 (2)	2%
3-Pack Most popular	$40.99	$122.97 (3)	5%
5-Pack Best value	$39.99	$199.95 (5)	7%

Description

Sermorelin (GRF 1-29 NH2) is a 29 amino acid peptide that reproduces the first 29 residues of human growth hormone releasing hormone (GHRH), the shortest fragment that keeps full activity at the GHRH receptor. Preclinical work uses it as a reference GHRH receptor agonist in pituitary signaling studies and compares it with modified analogs such as CJC-1295.

Core Research Peptides supplies it as 5mg of lyophilized powder in a sealed vial under SKU CRP-SER-5, at 99% purity. It reconstitutes in bacteriostatic water and stores at -20°C for long term work, 2 to 8°C once reconstituted.

Frequently Asked Questions

Our compounds are tested by an independent third-party laboratory, and we publish the certificate for each one in our COA library. COAs are available on request and show HPLC and mass spectrometry data.

Each COA includes: compound identity confirmation, purity percentage via HPLC, mass spectrometry verification, batch number, and testing date. All testing is performed by an independent third-party laboratory. For research purposes only.

Lyophilized (freeze-dried) peptides should be stored at -20°C and kept away from light and moisture for maximum stability. Once reconstituted, store at 4°C and use within 30 days. All compounds are shipped with appropriate packaging to maintain integrity during transit. For laboratory research use only.

Orders placed by 3 PM Central are dispatched the same day, seven days a week. Every order ships from the US with tracked shipping, and your tracking number is emailed the day it ships. Most domestic orders arrive within 2–5 business days.

No. All compounds sold by Core Research Peptides are strictly for in-vitro laboratory research purposes only. They are not intended for diagnostic use or therapeutic application. For research use only. By purchasing, you confirm you are a qualified researcher using these compounds in a laboratory setting.

The Catalog