US-BasedThird-Party TestedCOA PublishedFast Shipping

Retatrutide 5mg

Name: Retatrutide 5mg
Brand: Core Research Peptides
SKU: CRP-RET-5
Price: 159.00 USD
Availability: InStock

$159.00

Triple GLP-1/GIP/glucagon receptor agonist. 5mg lyophilized powder. ≥99% purity. For research use only.

Availability: In Stock

Research Use Only: All products currently listed on this site are for research purposes only.

Choose Quantity:

Bundle pricing, applied automatically in the cart. No code needed.
Qty	Per vial	Total	You save
Single vial	$159	$159	–
2-Pack	$151	$302 (2)	5%
3-Pack Most popular	$143	$429 (3)	10%
5-Pack Best value	$135	$675 (5)	15%

Free research guide for this compound In Stock

Secure card checkout. Visa and Mastercard accepted.

SKU: CRP-RET-5 Category: Research Compounds

Reconstitution quick calc

Vial mg + diluent mL

Enter vial contents and volume.

Open the full calculator →

You'll also need: Reconstitution Solution - $12.00

+ Add

Ordering for a lab or organization? Volume pricing is available on recurring and bulk orders.

Professional & Bulk Pricing

Research Background

About Retatrutide 5mg

What it is

Retatrutide is a synthetic peptide. It is a 39-amino-acid peptide chain, supplied as a lyophilized powder for laboratory research use.

Research areas

Retatrutide has been investigated in preclinical models of energy metabolism, body weight regulation, and glucose homeostasis. Studies have also examined its binding characteristics across the GIP, GLP-1, and glucagon receptor pathways.

Storage & handling

Store lyophilized Retatrutide in a freezer, protected from light and moisture, prior to reconstitution. After reconstitution, keep refrigerated, handle with standard laboratory technique, and minimize freeze-thaw cycling.

Research context

Retatrutide belongs to a class of triple-receptor incretin agonists, frequently compared in the metabolic-peptide literature against single- and dual-agonist compounds. Its multi-target design places it in a distinct pharmacological category from earlier incretin analogs. Retatrutide has also been studied in clinical research programs, a fact noted here only as literature context for laboratory researchers working with incretin-class peptides.

All compounds are supplied for in-vitro laboratory research and identification purposes only. Not for human or animal use.

🧬

Compound Specifications

Compound	Retatrutide
Scientific Name	Retatrutide (LY3437943) - Triple GLP-1/GIP/Glucagon Receptor Agonist
Sequence / Structure	YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS (39 aa)
Molecular Formula	C₂₂₁H₃₄₂N₄₆O₆₈
Molecular Weight	4,731.34 Da
CAS Number	2381089-83-2
Purity Standard	≥98%
Physical Form	Lyophilized powder
Storage Conditions	-20°C long-term; 2–8°C short-term

📋 View Certificate of Analysis

Specifications for research reference. For research use only. Not for human administration.

Description

Certificate of Analysis (PDF): Download COA – Janoshik | 99.862% | Third-party verified

Frequently Asked Questions

Our compounds are tested by an independent third-party laboratory, and we publish the certificate for each one in our COA library. COAs are available on request and show HPLC and mass spectrometry data.

Each COA includes: compound identity confirmation, purity percentage via HPLC, mass spectrometry verification, batch number, and testing date. All testing is performed by an independent third-party laboratory. For research purposes only.

Lyophilized (freeze-dried) peptides should be stored at -20°C and kept away from light and moisture for maximum stability. Once reconstituted, store at 4°C and use within 30 days. All compounds are shipped with appropriate packaging to maintain integrity during transit. For laboratory research use only.

Orders placed by 4PM ET are dispatched the same day, seven days a week. Every order ships from the US with tracked shipping, and your tracking number is emailed the day it ships. Most domestic orders arrive within 2–5 business days.

No. All compounds sold by Core Research Peptides are strictly for in-vitro laboratory research purposes only. They are not intended for human or animal consumption, diagnostic use, or therapeutic application. By purchasing, you confirm you are a qualified researcher using these compounds in a laboratory setting.

The Catalog