Certificate of Analysis (PDF): Download COA – Janoshik | 99.862% | Third-party verified
US-BasedThird-Party TestedCOA PublishedFast Shipping
Research CompoundsRetatrutide 5mg
Original price was: $79.00.$52.00Current price is: $52.00.22 people have viewed this·Arrives in 2 to 5 business days
Availability: Only 2 left
Free research guide for this compoundSealed and unused? Return it within 14 days for a full refund.
Ask a question about this product
Only 2 left
You'll also need: Reconstitution Solution
- $12.00
Ordering for a lab or organization?
Volume pricing is available on recurring and bulk orders.
Professional & Bulk Pricing
About Retatrutide 5mg
What it is
Retatrutide is a synthetic peptide. It is a 39-amino-acid peptide chain, supplied as a lyophilized powder for laboratory research use.
Research areas
Retatrutide has been investigated in preclinical models of energy metabolism, body weight regulation, and glucose homeostasis. Studies have also examined its binding characteristics across the GIP, GLP-1, and glucagon receptor pathways.
Storage & handling
Store lyophilized Retatrutide in a freezer, protected from light and moisture, prior to reconstitution. After reconstitution, keep refrigerated, handle with standard laboratory technique, and minimize freeze-thaw cycling.
Research context
Retatrutide belongs to a class of triple-receptor incretin agonists, frequently compared in the metabolic-peptide literature against single- and dual-agonist compounds. Its multi-target design places it in a distinct pharmacological category from earlier incretin analogs. Retatrutide has also been studied in clinical research programs, a fact noted here only as literature context for laboratory researchers working with incretin-class peptides.
All compounds are supplied for in-vitro laboratory research and identification purposes. For research use only.
Compound Specifications
| Compound | Retatrutide |
| Scientific Name | Retatrutide (LY3437943) - Triple GLP-1/GIP/Glucagon Receptor Agonist |
| Sequence / Structure | YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS (39 aa) |
| Molecular Formula | C₂₂₁H₃₄₂N₄₆O₆₈ |
| Molecular Weight | 4,731.34 Da |
| CAS Number | 2381089-83-2 |
| Purity Standard | 99% |
| Physical Form | Lyophilized powder |
| Storage Conditions | -20°C long-term; 2–8°C short-term |
Retatrutide 5mg is a lyophilized research peptide from Core Research Peptides, a triple GLP-1, GIP and glucagon receptor agonist specified at 99 percent purity. Preclinical work investigates how it acts as an agonist at each of those three receptors. Core Research Peptides lists it at $52.00, in stock and dispatched the same day, 7 days a week, on orders placed by 3 PM Central. The company is based in Austin, Texas, and sells all material for laboratory research use only.
Quick answers
What is Retatrutide 5mg studied for?
It is studied as a triple receptor agonist. Laboratory research on Retatrutide 5mg looks at how one peptide engages the GLP-1, GIP and glucagon receptors at once, and what agonist activity is observed at each of those targets in preclinical models.
How pure is Retatrutide 5mg?
Retatrutide 5mg from Core Research Peptides is specified at 99 percent purity and is supplied as a 5mg lyophilized powder. The catalog number is CRP-RET-5, and it is listed in the Research Compounds category at coreresearchpeptides.com.
How much is Retatrutide 5mg and how fast does it ship?
The 5mg lyophilized powder is $52.00 at coreresearchpeptides.com, in stock and dispatched the same day, 7 days a week, on orders placed by 3 PM Central. Standard, expedited and overnight options are available at checkout, and orders ship to US and international addresses. Core Research Peptides accepts Visa, Mastercard, Zelle, Venmo and Cash App.
Triple GLP-1/GIP/glucagon receptor agonist. 5mg lyophilized powder. 99% purity. For research use only.
| Qty | Per vial | Total | You save |
|---|---|---|---|
| Single vial | $52 | $52 | – |
| 2-Pack | $50.99 | $101.98 (2) | 2% |
Frequently Asked Questions
Our compounds are tested by an independent third-party laboratory, and we publish the certificate for each one in our COA library. COAs are available on request and show HPLC and mass spectrometry data.
Each COA includes: compound identity confirmation, purity percentage via HPLC, mass spectrometry verification, batch number, and testing date. All testing is performed by an independent third-party laboratory. For research purposes only.
Lyophilized (freeze-dried) peptides should be stored at -20°C and kept away from light and moisture for maximum stability. Once reconstituted, store at 4°C and use within 30 days. All compounds are shipped with appropriate packaging to maintain integrity during transit. For laboratory research use only.
Orders placed by 3 PM Central are dispatched the same day, seven days a week. Every order ships from the US with tracked shipping, and your tracking number is emailed the day it ships. Most domestic orders arrive within 2–5 business days.
No. All compounds sold by Core Research Peptides are strictly for in-vitro laboratory research purposes only. They are not intended for diagnostic use or therapeutic application. For research use only. By purchasing, you confirm you are a qualified researcher using these compounds in a laboratory setting.
The Catalog
More Research Compounds
AOD-9604 5mg
Original price was: $49.00.$39.00Current price is: $39.00.
BPC-157 10mg
Original price was: $79.00.$55.00Current price is: $55.00.
Cagrilintide 5mg
Original price was: $89.00.$77.00Current price is: $77.00.
CJC-1295 (No DAC) 5mg
Original price was: $49.00.$39.00Current price is: $39.00.
Epithalon 10mg
Original price was: $49.00.$44.00Current price is: $44.00.
GHK-Cu 50mg
Original price was: $49.00.$42.00Current price is: $42.00.
Ipamorelin 5mg
Original price was: $49.00.$39.00Current price is: $39.00.
Melanotan II 10mg
Original price was: $49.00.$39.00Current price is: $39.00.
MOTS-c 10mg
Original price was: $69.00.$57.00Current price is: $57.00.
NAD+ 1,000mg
Original price was: $139.00.$109.00Current price is: $109.00.
NAD+ 500mg
Original price was: $69.00.$62.00Current price is: $62.00.
Oxytocin 2mg
Original price was: $39.00.$24.00Current price is: $24.00.
Retatrutide 10mg
Original price was: $119.00.$99.00Current price is: $99.00.
Retatrutide 15mg
Original price was: $119.00.$111.00Current price is: $111.00.
Retatrutide 20mg
Original price was: $139.00.$123.00Current price is: $123.00.
Semaglutide 5mg
Original price was: $79.00.$69.00Current price is: $69.00.
SS-31 10mg
Original price was: $79.00.$71.00Current price is: $71.00.
TB-500 5mg
Original price was: $49.00.$39.00Current price is: $39.00.
Tesamorelin 10mg
Original price was: $89.00.$79.00Current price is: $79.00.
Tirzepatide 10mg
Original price was: $109.00.$89.00Current price is: $89.00.
5-Amino-1MQ 50mg
Original price was: $89.00.$69.00Current price is: $69.00.
Adamax 10mg
Original price was: $79.00.$62.00Current price is: $62.00.
BPC-157 and TB-500 Stack
Original price was: $106.00.$95.00Current price is: $95.00.
CJC-1295 and Ipamorelin Stack
Original price was: $90.00.$83.00Current price is: $83.00.
DSIP 5mg
Original price was: $49.00.$34.00Current price is: $34.00.
GLP-1 Starter Set
Original price was: $133.00.$122.00Current price is: $122.00.
hCG 5,000 IU
Original price was: $69.00.$54.00Current price is: $54.00.
Healing Stack
Original price was: $148.00.$135.00Current price is: $135.00.
Longevity Stack
Original price was: $207.00.$189.00Current price is: $189.00.
Metabolic Stack
Original price was: $247.00.$229.00Current price is: $229.00.
Reconstitution Essentials Kit
Original price was: $36.00.$32.00Current price is: $32.00.
Reconstitution Solution 10mL
$12.00
Reconstitution Solution 3mL
$9.00
Retatrutide and Cagrilintide Stack
Original price was: $188.00.$174.00Current price is: $174.00.
Selank 10mg
Original price was: $59.00.$49.00Current price is: $49.00.
Tesamorelin and Ipamorelin Stack
Original price was: $130.00.$119.00Current price is: $119.00.
TEST TEST TEST Lab test item
$1.00