Original price was: $119.00.$99.00Current price is: $99.00.180 people have viewed this·Arrives in 2 to 5 business days
Availability: Only 4 left
Free research guide for this compoundSealed and unused? Return it within 14 days for a full refund.
Ask a question about this product
Only 4 leftRetatrutide is a synthetic peptide. It is a 39-amino-acid peptide chain, supplied as a lyophilized powder for laboratory research use.
Retatrutide has been investigated in preclinical models of energy metabolism, body weight regulation, and glucose homeostasis. Studies have also examined its binding characteristics across the GIP, GLP-1, and glucagon receptor pathways.
Store lyophilized Retatrutide in a freezer, protected from light and moisture, prior to reconstitution. After reconstitution, keep refrigerated, handle with standard laboratory technique, and minimize freeze-thaw cycling.
Retatrutide belongs to a class of triple-receptor incretin agonists, frequently compared in the metabolic-peptide literature against single- and dual-agonist compounds. Its multi-target design places it in a distinct pharmacological category from earlier incretin analogs. Retatrutide has also been studied in clinical research programs, a fact noted here only as literature context for laboratory researchers working with incretin-class peptides.
All compounds are supplied for in-vitro laboratory research and identification purposes. For research use only.
| Compound | Retatrutide |
| Scientific Name | Retatrutide (LY3437943) - Triple GLP-1/GIP/Glucagon Receptor Agonist |
| Sequence / Structure | YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS (39 aa) |
| Molecular Formula | C₂₂₁H₃₄₂N₄₆O₆₈ |
| Molecular Weight | 4,731.34 Da |
| CAS Number | 2381089-83-2 |
| Purity Standard | 99% |
| Physical Form | Lyophilized powder |
| Storage Conditions | -20°C long-term; 2–8°C short-term |
Retatrutide 10mg is a triple-receptor agonist research compound from Core Research Peptides, targeting the GLP-1, GIP, and glucagon receptors. Laboratory research investigates simultaneous agonism at these three receptors and how that combined signaling behaves in research models. It is listed at $99.00, with stock and dispatch as follows: in stock and dispatched the same day, 7 days a week, on orders placed by 3 PM Central.
Quick answers
Research interest in Retatrutide comes from its acting at three receptor targets rather than a single one. Laboratory work looks at what happens when GLP-1, GIP, and glucagon signaling are engaged together, which is what the term triple-receptor agonist describes.
Core Research Peptides lists Retatrutide 10mg at $99.00, which covers one 10mg unit of lyophilized material under SKU CRP-RET-10. Availability and dispatch: in stock and dispatched the same day, 7 days a week, on orders placed by 3 PM Central. Current shipping options and payment methods are shown at checkout on coreresearchpeptides.com.
Core Research Peptides lists Retatrutide 10mg under SKU CRP-RET-10 in its Research Compounds category. Each unit holds 10mg of lyophilized material and purity is specified at 99%. The product page is https://coreresearchpeptides.com/product/retatrutide-10mg/.
Triple-receptor agonist (GLP-1/GIP/Glucagon) research compound. 10mg lyophilized. 99% purity, COA available.
| Qty | Per vial | Total | You save |
|---|---|---|---|
| Single vial | $99 | $99 | – |
| 2-Pack | $95.99 | $191.98 (2) | 3% |
| 3-Pack Most popular | $93.99 | $281.97 (3) | 5% |
Certificate of Analysis (PDF): Download COA – Janoshik | 99.862% | Third-party verified
Sourcing guide: Retatrutide for Sale: Research Peptide Purity, COAs, and Sourcing – how to read the batch COA, what purity figures mean, and what to check before buying.
Our compounds are tested by an independent third-party laboratory, and we publish the certificate for each one in our COA library. COAs are available on request and show HPLC and mass spectrometry data.
Each COA includes: compound identity confirmation, purity percentage via HPLC, mass spectrometry verification, batch number, and testing date. All testing is performed by an independent third-party laboratory. For research purposes only.
Lyophilized (freeze-dried) peptides should be stored at -20°C and kept away from light and moisture for maximum stability. Once reconstituted, store at 4°C and use within 30 days. All compounds are shipped with appropriate packaging to maintain integrity during transit. For laboratory research use only.
Orders placed by 3 PM Central are dispatched the same day, seven days a week. Every order ships from the US with tracked shipping, and your tracking number is emailed the day it ships. Most domestic orders arrive within 2–5 business days.
No. All compounds sold by Core Research Peptides are strictly for in-vitro laboratory research purposes only. They are not intended for diagnostic use or therapeutic application. For research use only. By purchasing, you confirm you are a qualified researcher using these compounds in a laboratory setting.
AOD-9604 5mg
Original price was: $49.00.$39.00Current price is: $39.00.
BPC-157 10mg
Original price was: $79.00.$55.00Current price is: $55.00.
Cagrilintide 5mg
Original price was: $89.00.$77.00Current price is: $77.00.
CJC-1295 (No DAC) 5mg
Original price was: $49.00.$39.00Current price is: $39.00.
Epithalon 10mg
Original price was: $49.00.$44.00Current price is: $44.00.
GHK-Cu 50mg
Original price was: $49.00.$42.00Current price is: $42.00.
Ipamorelin 5mg
Original price was: $49.00.$39.00Current price is: $39.00.
Melanotan II 10mg
Original price was: $49.00.$39.00Current price is: $39.00.
MOTS-c 10mg
Original price was: $69.00.$57.00Current price is: $57.00.
NAD+ 1,000mg
Original price was: $139.00.$109.00Current price is: $109.00.
NAD+ 500mg
Original price was: $69.00.$62.00Current price is: $62.00.
Oxytocin 2mg
Original price was: $39.00.$24.00Current price is: $24.00.
Retatrutide 15mg
Original price was: $119.00.$111.00Current price is: $111.00.
Retatrutide 20mg
Original price was: $139.00.$123.00Current price is: $123.00.
Retatrutide 5mg
Original price was: $79.00.$52.00Current price is: $52.00.
Semaglutide 5mg
Original price was: $79.00.$69.00Current price is: $69.00.
SS-31 10mg
Original price was: $79.00.$71.00Current price is: $71.00.
TB-500 5mg
Original price was: $49.00.$39.00Current price is: $39.00.
Tesamorelin 10mg
Original price was: $89.00.$79.00Current price is: $79.00.
Tirzepatide 10mg
Original price was: $109.00.$89.00Current price is: $89.00.
5-Amino-1MQ 50mg
Original price was: $89.00.$69.00Current price is: $69.00.
Adamax 10mg
Original price was: $79.00.$62.00Current price is: $62.00.
BPC-157 and TB-500 Stack
Original price was: $106.00.$95.00Current price is: $95.00.
CJC-1295 and Ipamorelin Stack
Original price was: $90.00.$83.00Current price is: $83.00.
DSIP 5mg
Original price was: $49.00.$34.00Current price is: $34.00.
GLP-1 Starter Set
Original price was: $133.00.$122.00Current price is: $122.00.
hCG 5,000 IU
Original price was: $69.00.$54.00Current price is: $54.00.
Healing Stack
Original price was: $148.00.$135.00Current price is: $135.00.
Longevity Stack
Original price was: $207.00.$189.00Current price is: $189.00.
Metabolic Stack
Original price was: $247.00.$229.00Current price is: $229.00.
Reconstitution Essentials Kit
Original price was: $36.00.$32.00Current price is: $32.00.
Reconstitution Solution 10mL
$12.00
Reconstitution Solution 3mL
$9.00
Retatrutide and Cagrilintide Stack
Original price was: $188.00.$174.00Current price is: $174.00.
Selank 10mg
Original price was: $59.00.$49.00Current price is: $49.00.
Tesamorelin and Ipamorelin Stack
Original price was: $130.00.$119.00Current price is: $119.00.
TEST TEST TEST Lab test item
$1.00
Core Research Club members get 15% off a first order, plus restock alerts, new-product notice and research guides.
Research use only. Unsubscribe anytime.
Open in Safari for the fastest checkout
Open in Safari
Core Research Peptides is a US-based research supply company headquartered in Austin, Texas. Every compound we stock is independently third-party tested, and we publish the certificate for it in our COA library. Standard US shipping is $12, free over $150, with expedited and overnight options, and we ship internationally. We accept Visa and Mastercard, plus Bitcoin, Zelle, Cash App and Venmo. US-based support.
Call or text (512) 643-4570. Email info@coreresearchpeptides.com.
Toll-free: (844) 393-9441
Added to cart
