$239.00
Triple-receptor agonist (GLP-1/GIP/Glucagon) research compound. 10mg lyophilized. ≥98% purity, COA available.
Availability: In Stock
Secure card checkout. Visa and Mastercard accepted.
Retatrutide is a synthetic peptide. It is a 39-amino-acid peptide chain, supplied as a lyophilized powder for laboratory research use.
Retatrutide has been investigated in preclinical models of energy metabolism, body weight regulation, and glucose homeostasis. Studies have also examined its binding characteristics across the GIP, GLP-1, and glucagon receptor pathways.
Store lyophilized Retatrutide in a freezer, protected from light and moisture, prior to reconstitution. After reconstitution, keep refrigerated, handle with standard laboratory technique, and minimize freeze-thaw cycling.
Retatrutide belongs to a class of triple-receptor incretin agonists, frequently compared in the metabolic-peptide literature against single- and dual-agonist compounds. Its multi-target design places it in a distinct pharmacological category from earlier incretin analogs. Retatrutide has also been studied in clinical research programs, a fact noted here only as literature context for laboratory researchers working with incretin-class peptides.
All compounds are supplied for in-vitro laboratory research and identification purposes only. Not for human or animal use.
| Compound | Retatrutide |
| Scientific Name | Retatrutide (LY3437943) - Triple GLP-1/GIP/Glucagon Receptor Agonist |
| Sequence / Structure | YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS (39 aa) |
| Molecular Formula | C₂₂₁H₃₄₂N₄₆O₆₈ |
| Molecular Weight | 4,731.34 Da |
| CAS Number | 2381089-83-2 |
| Purity Standard | ≥98% |
| Physical Form | Lyophilized powder |
| Storage Conditions | -20°C long-term; 2–8°C short-term |
Specifications for research reference. For research use only. Not for human administration.
Certificate of Analysis (PDF): Download COA – Janoshik | 99.862% | Third-party verified
Sourcing guide: Retatrutide for Sale: Research Peptide Purity, COAs, and Sourcing – how to read the batch COA, what purity figures mean, and what to check before buying.
Our compounds are tested by an independent third-party laboratory, and we publish the certificate for each one in our COA library. COAs are available on request and show HPLC and mass spectrometry data.
Each COA includes: compound identity confirmation, purity percentage via HPLC, mass spectrometry verification, batch number, and testing date. All testing is performed by an independent third-party laboratory. For research purposes only.
Lyophilized (freeze-dried) peptides should be stored at -20°C and kept away from light and moisture for maximum stability. Once reconstituted, store at 4°C and use within 30 days. All compounds are shipped with appropriate packaging to maintain integrity during transit. For laboratory research use only.
Orders placed by 4PM ET are dispatched the same day, seven days a week. Every order ships from the US with tracked shipping, and your tracking number is emailed the day it ships. Most domestic orders arrive within 2–5 business days.
No. All compounds sold by Core Research Peptides are strictly for in-vitro laboratory research purposes only. They are not intended for human or animal consumption, diagnostic use, or therapeutic application. By purchasing, you confirm you are a qualified researcher using these compounds in a laboratory setting.
AOD-9604 5mg
$45.00
BPC-157 10mg
$44.00
Epithalon 10mg
$52.00
GHK-Cu 50mg
$52.00
Melanotan II 10mg
$39.00
MOTS-c 10mg
$75.00
NAD+ 1,000mg
$109.00
Oxytocin 2mg
$28.00
Retatrutide 5mg
$159.00
Semaglutide 5mg
$99.00
TB-500 5mg
$75.00
Tirzepatide 10mg
$119.00
5-Amino-1MQ 50mg
$58.00
Adamax 10mg
$62.00
CJC-1295 (No DAC) 5mg
$45.00
DSIP 5mg
$38.00
hCG 5,000 IU
$65.00
Ipamorelin 5mg
$36.00
Reconstitution Solution 10mL
$12.00
Selank 10mg
$48.00
Tesamorelin 10mg
$82.00
Core Research Peptides is a US-based research supply company headquartered in Austin, Texas. Every compound we stock is independently third-party tested, and we publish the certificate for it in our COA library. Standard US shipping is $12, free over $150, with expedited and overnight options, and we ship internationally. We accept Visa and Mastercard, plus Bitcoin, Zelle, Cash App and Venmo. US-based support.
Secure card checkoutAdded to cart
Core Research Peptides supplies research-grade compounds for laboratory use only. By entering this site, you confirm you are a qualified researcher, 21 or older, and that you will use these compounds exclusively for in-vitro research.
Not for human consumption. Not sold to individuals under 21. Research use only.